Antiquaquibacter oligotrophicus: LH407_13755 Help Entry LH407_13755       CDS       T09620                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aog  Antiquaquibacter oligotrophicus Pathway aog01100   Metabolic pathways aog01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aog00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH407_13755    00074 Mycolic acid biosynthesis     LH407_13755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH407_13755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Motif Other DBs NCBI-ProteinID:  UDF13205 LinkDB All DBs Position complement(2803128..2803376) Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVSFITSAQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcattgtccacggaagaagtactggccggcctggccgagctcatcaacgacgagacc ggcattgcgacggacaccgtcgagctggacaagtcgttcaccgacgacctcgacatcgac tccatttcgatgatgacgatcgtcgtcaacgctgaagagaagttcgacgtcaagattccc gacgaagaggtcaagaacctcaagaccgtcggcgacgccgtgagcttcatcaccagcgcg cagggctga

DBGET integrated database retrieval system