Anaplasma ovis: AOV_01460 Help Entry AOV_01460         CDS       T05659                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism aoh  Anaplasma ovis Brite KEGG Orthology (KO) [BR:aoh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aoh03032]     AOV_01460    03036 Chromosome and associated proteins [BR:aoh03036]     AOV_01460    03400 DNA repair and recombination proteins [BR:aoh03400]     AOV_01460 DNA replication proteins [BR:aoh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AOV_01460 Chromosome and associated proteins [BR:aoh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AOV_01460 DNA repair and recombination proteins [BR:aoh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AOV_01460 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 Kazal_C7 Motif Other DBs NCBI-ProteinID:  ASI47570 UniProt:  A0A2Z2LEQ7 LinkDB All DBs Position complement(362104..362379) Genome browser AA seq 91 aa AA seqDB search MSKEIIVRALMSNLGFTKKDSSSAYDVVMSAVKTALETNHSIRLHNVGTLHVIQCAEKKY HNPKTGRLETLPPKRRVRFRSSRKLLDTVNV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtaaggagatcatagtcagggcattgatgtcaaatctgggcttcacgaagaaggat tcgagcagtgcctacgatgtggttatgtcagcggttaagactgcgctggaaactaaccat tccatccgtcttcacaacgttggcacgttgcacgtcattcagtgcgccgagaagaagtat cacaatcccaagactggacgtcttgaaactctacccccgaagaggagggtgaggttcagg tctagtagaaagttgttggacacggtaaatgtgtag

DBGET integrated database retrieval system