Amycolatopsis keratiniphila: AORI_4131 Help Entry AORI_4131         CDS       T02678                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aoi  Amycolatopsis keratiniphila Brite KEGG Orthology (KO) [BR:aoi00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AORI_4131 Enzymes [BR:aoi01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      AORI_4131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_9 GST_N DUF7489 Motif Other DBs NCBI-ProteinID:  AGM06716 UniProt:  R4T2Q9 LinkDB All DBs Position 4529604..4529843 Genome browser AA seq 79 aa AA seqDB search MSDLIVYGAGWCPDVKRSRALLDSKGVEYAYIDVEADSGAEETVRALQNGERRIPTIVWP DGTHLVEPSDDELTAHLNR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacctgatcgtgtacggcgccggctggtgccccgacgtcaaacgcagccgggcc ctgctggactcgaagggcgtcgagtacgcctacatcgacgtcgaagcggactccggcgcg gaggagacggtgcgcgcgctgcagaacggtgagcggcggatcccgaccatcgtctggccg gacggcacccacctggtcgagccgagcgacgacgagctcaccgcgcacctgaaccggtga

DBGET integrated database retrieval system