Bradyrhizobium oligotrophicum: S58_55200 Help Entry S58_55200         CDS       T02484                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aol  Bradyrhizobium oligotrophicum Pathway aol00998   Biosynthesis of various antibiotics aol01100   Metabolic pathways aol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     S58_55200    00074 Mycolic acid biosynthesis     S58_55200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     S58_55200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAM91497 UniProt:  M4ZCG8 LinkDB All DBs Position complement(6269907..6270173) Genome browser AA seq 88 aa AA seqDB search MAFGAECKMTAEIYERLNKVFIETFGDETIKITPEMTADDLDEWDSVTHISLVLAVEEEF GQRLNAAEIGNLENVAAMVALLQKKMAR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcctttggggcggagtgcaaaatgacggctgagatctacgagcgtttgaacaaggtc ttcatcgagacgttcggtgacgagaccatcaagataacccccgagatgacggccgacgac ctcgatgaatgggattccgtcacgcacatctcgttggtgctggcggtcgaggaggagttc gggcaacgcctcaatgccgcggaaatcggcaatctcgagaatgtcgcggcgatggtcgct ttgctccagaagaagatggcgcgttag

DBGET integrated database retrieval system