Aquabacterium olei: DEH84_06165 Help Entry DEH84_06165       CDS       T05429                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism aon  Aquabacterium olei Brite KEGG Orthology (KO) [BR:aon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aon03036]     DEH84_06165    03400 DNA repair and recombination proteins [BR:aon03400]     DEH84_06165 Chromosome and associated proteins [BR:aon03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DEH84_06165 DNA repair and recombination proteins [BR:aon03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DEH84_06165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Flg_hook Motif Other DBs NCBI-ProteinID:  AWI53061 UniProt:  A0A2U8FPS5 LinkDB All DBs Position 1372673..1372954 Genome browser AA seq 93 aa AA seqDB search MMTPEQEAVLRAIRKLVDFWHITPSELHSDAPVVAAVPRPDESPPPARHRYRHPLSGETW DGQGAQPQWLREALTREGYTVQELRVSEDVAPE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgatgaccccagaacaagaggccgtgctgcgtgcgatccgcaagctcgtggatttttgg catatcacgccaagcgagctgcactccgatgcccccgttgtggcagccgtgccgcggccg gatgagtctccgccgccggcccgccaccggtaccgtcatccattgagcggtgagacgtgg gacgggcagggtgcacagccgcaatggctgcgtgaggcgctgacgcgcgagggctacacc gtgcaggaactgcgcgtgtccgaagacgtggcgcccgagtga

DBGET integrated database retrieval system