Aquabacterium olei: DEH84_14925 Help Entry DEH84_14925       CDS       T05429                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism aon  Aquabacterium olei Brite KEGG Orthology (KO) [BR:aon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aon03110]     DEH84_14925 (grxC) Chaperones and folding catalysts [BR:aon03110]  Protein folding catalysts   Protein disulfide isomerase    DEH84_14925 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_3 Thioredoxin_2 CLIC-like_N Motif Other DBs NCBI-ProteinID:  AWI54570 UniProt:  A0A2U8FU74 LinkDB All DBs Position 3323387..3323644 Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTQVCPYCQRAKMLLKQRGVEAIEEIRIDVDPAQRDQMMAITGRRTVPQIFIG DTHVGGCDDLIALDQKGGLLPLLNG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtcaagatgtacaccacccaggtctgcccttactgccagcgggccaagatg ctgctcaagcagcgcggggtcgaggccatcgaggaaatccgcatcgacgtggacccggcc cagcgcgaccagatgatggccatcaccggccgccgcaccgtgccacagatcttcatcggc gacacccatgtgggcggctgcgacgacctcatcgcgctggaccagaagggcggcctgctg ccgctgctcaacggctga

DBGET integrated database retrieval system