Amycolatopsis orientalis: SD37_09605 Help Entry SD37_09605        CDS       T06703                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aori  Amycolatopsis orientalis Pathway aori00998   Biosynthesis of various antibiotics aori01100   Metabolic pathways aori01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aori00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SD37_09605    00074 Mycolic acid biosynthesis     SD37_09605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SD37_09605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANN15874 UniProt:  A0A193BUM0 LinkDB All DBs Position complement(2009195..2009431) Genome browser AA seq 78 aa AA seqDB search MTVYERVEAMLTKAFGVEPEAISREATFDEMDLDSLAQVEFSEVLSEAFGFDLDSEEFVK LENLGELIDMLERQEARA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgactgtttacgagcgcgtcgaagcaatgctgaccaaagccttcggcgtggaacccgag gccatttcgagggaagcgaccttcgacgagatggacctcgattccctggcgcaggtcgag ttcagtgaagtcctgtccgaggcgttcgggttcgacctcgattcggaggagttcgtcaag ctggagaacctgggcgagctgatcgacatgctcgagcggcaggaggcacgtgcgtga

DBGET integrated database retrieval system