Amycolatopsis orientalis: SD37_18725 Help Entry SD37_18725        CDS       T06703                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aori  Amycolatopsis orientalis Pathway aori00998   Biosynthesis of various antibiotics aori01100   Metabolic pathways aori01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aori00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SD37_18725    00074 Mycolic acid biosynthesis     SD37_18725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SD37_18725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANN17482 UniProt:  A0A193BZ30 LinkDB All DBs Position 4296982..4297257 Genome browser AA seq 91 aa AA seqDB search MTSESVSREQIASVTTEYLATELKIPAAGIAGTDVLRELPGADSMKMLRVVSKLERRWDV EFDDEAIFAVKTVDELVVMVEKSVSGDLAAS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccagcgagtccgtcagccgcgagcagatcgcctcggtcaccaccgaatacctcgcc accgagctgaagatccccgccgccgggatcgccggtaccgacgtgctcagggagctgccc ggcgccgactccatgaagatgctgcgcgtggtgtccaaattggagcgtcgctgggacgtg gagttcgacgacgaggccatcttcgcggtgaagaccgtcgacgaactggtcgtgatggtg gagaagagtgtcagcggggacctggcggcgtcatga

DBGET integrated database retrieval system