Amycolatopsis orientalis: SD37_28430 Help Entry SD37_28430        CDS       T06703                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aori  Amycolatopsis orientalis Pathway aori00998   Biosynthesis of various antibiotics aori01100   Metabolic pathways aori01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aori00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SD37_28430    00074 Mycolic acid biosynthesis     SD37_28430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SD37_28430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANN19158 UniProt:  A0A193C455 LinkDB All DBs Position 6587477..6587722 Genome browser AA seq 81 aa AA seqDB search MADNAEILAGLAEIVEEVAGVAQDDVTAEKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DELANLKTVGDAVNYVSANSK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggcagacaacgcagagatcctcgccggcctcgccgagatcgtcgaagaggtcgccggt gtggcgcaggacgacgtgaccgccgagaagtccttcgtggacgacctcgacatcgactcg ctgtccatggtggagatcgctgttcaggccgaggacaagttcggcgtcaagatcccggac gacgagctggcgaacctgaagaccgttggcgacgcggtgaactacgtgtccgccaactcc aagtaa

DBGET integrated database retrieval system