Amycolatopsis orientalis: SD37_33715 Help Entry SD37_33715        CDS       T06703                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism aori  Amycolatopsis orientalis Pathway aori00261   Monobactam biosynthesis aori01100   Metabolic pathways aori01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aori00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SD37_33715  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aori01008]     SD37_33715 Polyketide biosynthesis proteins [BR:aori01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SD37_33715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANN20075 UniProt:  Q8RN06 LinkDB All DBs Position complement(7756101..7756310) Genome browser AA seq 69 aa AA seqDB search MTNPFDNEDGSFFVLVNDEGQHSLWPSFAEVPSGWTRVLGETTRQECLAYVEENWTDLRP KSLIQEAGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacaacgaagacggttcctttttcgttctggtcaacgacgagggg cagcactccctgtggccgtccttcgccgaggtgccgtcgggctggacccgggtgctcggc gagaccacccgccaggaatgcctcgcctatgtcgaggagaactggacggacctccggccg aagagcctcatccaggaagcgggcgcctga

DBGET integrated database retrieval system