Anaeromyxobacter oryzae: AMOR_48690 Help Entry AMOR_48690        CDS       T08524                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aory  Anaeromyxobacter oryzae Pathway aory01100   Metabolic pathways aory01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aory00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMOR_48690 (acpP)    00074 Mycolic acid biosynthesis     AMOR_48690 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMOR_48690 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 MAP Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  BDG05873 LinkDB All DBs Position 5611042..5611281 Genome browser AA seq 79 aa AA seqDB search MSANIEQKVKNIIADQLGVGEDEIKITSSFIEDLGADSLDIVELVMAMEEEFEVEIPDEE AENIKTVQDAVNYITTHKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcggccaacatcgagcagaaggtgaagaacatcatcgcggaccagctgggcgtcggc gaggacgagatcaagatcacctcgtccttcatcgaggacctcggcgcggactccctcgac atcgtcgagctcgtcatggcgatggaggaggagttcgaggtcgagatcccggacgaggaa gccgagaacatcaagaccgtccaggacgcggtgaactacatcaccacgcacaagaagtaa

DBGET integrated database retrieval system