Anaeromyxobacter oryzae: AMOR_52470 Help Entry AMOR_52470        CDS       T08524                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism aory  Anaeromyxobacter oryzae Pathway aory03060   Protein export aory03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:aory00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AMOR_52470  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AMOR_52470  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:aory02044]     AMOR_52470 Secretion system [BR:aory02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AMOR_52470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BDG06251 LinkDB All DBs Position complement(6019116..6019316) Genome browser AA seq 66 aa AA seqDB search MPRLGMPELIIILLIVVVLFGANKLPQLGAGLGQGIRSFKKAMGDSADEDKAASAKTSTT DSSKQA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgcccaggctcggcatgccagagctgatcatcatcctcctcatcgtcgtcgtgctgttc ggggcgaacaagcttccgcagctcggcgccggcctcggtcaggggatccgcagcttcaag aaggcgatgggcgacagcgcggacgaggacaaggccgcgagcgccaagacgtcgacgacg gacagctcgaagcaggcctga

DBGET integrated database retrieval system