Anaeromyxobacter oryzae: AMOR_58800 Help Entry AMOR_58800        CDS       T08524                                  Symbol grx Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism aory  Anaeromyxobacter oryzae Brite KEGG Orthology (KO) [BR:aory00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aory03110]     AMOR_58800 (grx) Chaperones and folding catalysts [BR:aory03110]  Protein folding catalysts   Protein disulfide isomerase    AMOR_58800 (grx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 SH3BGR GST_N_2 GST_N Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  BDG06884 LinkDB All DBs Position 6716115..6716378 Genome browser AA seq 87 aa AA seqDB search MAVPKVTVYTKHNCPYCVRAKRLLEKKGVAFEEIDVEGDDALRTWLREKTGQMTVPQVFV GERSLGGFSDVDALDRQGRLDPILRGD NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccgttcccaaggtgaccgtctacacgaagcacaactgcccgtactgcgtccgcgcc aagcggctcctcgagaagaagggcgtcgcgttcgaggagatcgacgtcgagggcgacgac gcgctccggacgtggctccgcgagaagaccggccagatgacggtcccgcaggtgttcgtg ggggaacgctccctgggtggcttctcggacgtcgacgcgctggaccggcagggacgcctc gatcccatcctgcgcggggactga

DBGET integrated database retrieval system