Acetobacter orientalis: AcetOri_orf00385 Help Entry AcetOri_orf00385  CDS       T06324                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aot  Acetobacter orientalis Pathway aot01100   Metabolic pathways aot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AcetOri_orf00385    00074 Mycolic acid biosynthesis     AcetOri_orf00385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AcetOri_orf00385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBC78603 UniProt:  A0A252A503 LinkDB All DBs Position complement(232307..232546) Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVEESKVTPEASFIDDLGADSLDTVELVMAFEEAFNVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgataaggttaagaaaattgtagtcgagcacctcggtgttgaagaa agcaaggttacgccagaagcgtcattcatcgacgatctgggcgcagacagcctcgacacc gtagaactcgttatggctttcgaagaagccttcaatgttgaaattccggaagacgctgca gaaaaaatcgctacagtgaaagacgccattgactacattgaaaagcagaaagctgcctga

DBGET integrated database retrieval system