Acetobacter orientalis: AcetOri_orf01286 Help Entry AcetOri_orf01286  CDS       T06324                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism aot  Acetobacter orientalis Brite KEGG Orthology (KO) [BR:aot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aot03110]     AcetOri_orf01286    03029 Mitochondrial biogenesis [BR:aot03029]     AcetOri_orf01286 Chaperones and folding catalysts [BR:aot03110]  Heat shock proteins   HSP10    AcetOri_orf01286 Mitochondrial biogenesis [BR:aot03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AcetOri_orf01286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BBC79225 UniProt:  A0A2Z5ZFQ3 LinkDB All DBs Position 815221..815406 Genome browser AA seq 61 aa AA seqDB search MEGKVVAVGPGARNEQGQIVALDVKAGDTILFGKWSGTEVKIDGEDLLIMKESDILGIIA A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaaggcaaagtggttgcagttggcccaggcgcacgcaacgaacagggtcagatcgtg gcgcttgatgtcaaggctggcgacaccattctgttcggcaaatggtctggcactgaagtg aagatcgacggggaagacctgctgatcatgaaagaaagcgacattctgggcattattgct gcctaa

DBGET integrated database retrieval system