Actinoplanes oblitus: ACTOB_007757
Help
Entry
ACTOB_007757 CDS
T09687
Symbol
thrC
Name
(GenBank) threonine synthase
KO
K01733
threonine synthase [EC:
4.2.3.1
]
Organism
aou
Actinoplanes oblitus
Pathway
aou00260
Glycine, serine and threonine metabolism
aou00750
Vitamin B6 metabolism
aou01100
Metabolic pathways
aou01110
Biosynthesis of secondary metabolites
aou01120
Microbial metabolism in diverse environments
aou01230
Biosynthesis of amino acids
Module
aou_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
aou00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
ACTOB_007757 (thrC)
09108 Metabolism of cofactors and vitamins
00750 Vitamin B6 metabolism
ACTOB_007757 (thrC)
Enzymes [BR:
aou01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.3 Acting on phosphates
4.2.3.1 threonine synthase
ACTOB_007757 (thrC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PALP
Motif
Other DBs
NCBI-ProteinID:
WIM95634
UniProt:
A0ABY8WCP2
LinkDB
All DBs
Position
complement(8752245..8753294)
Genome browser
AA seq
349 aa
AA seq
DB search
MWRGLIEAYRDRLPVTEATPVVTLHEGNTPLVPAPVLSQRIGADVYLKVEGANPTGSFKD
RGMTMAVSKAVEEGAKAIICASTGNTSASAAAYAARAGITCAVLVPQGKIALGKLAQALV
HGARLLQVDGNFDDCLALASKLSQDYPVALVNSVNIFRLHGQKTASFEIVEALGDAPDIH
CLPVGNAGNISAYWMGYQEDKDAGNSTRLPRMYGFQASGAAPIVTGKVVEQPSTIATAIR
IGNPASWTKALDARDASGGLISAVTDRDILNAYRLLAREVGVFVELGSAASVAGLLQQAA
AGKIPAGSRVVCTVTGHGLKDPEWAISTAPSPTVIANDALIAAKALDLA
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
atgtggcggggattgatcgaggcgtaccgggaccggcttccggtgaccgaggccaccccg
gtggtcacgttgcacgagggcaacacgccgctggtgccggcgccggtgctctcccagcgg
atcggcgccgacgtctacctgaaggtggagggcgccaacccgaccggttcgttcaaggac
cgggggatgaccatggcggtctccaaggcggtcgaggagggcgccaaggcgatcatctgc
gcgtccaccggcaacacctcggcgtcggccgcggcgtacgctgcccgcgccgggatcacc
tgcgccgtgctggtgccgcagggcaagatcgcgctgggcaagctggcccaggccctggtg
cacggggcccggctgctccaggtggacggcaacttcgacgactgcctggcgctcgcctcg
aaactgtcccaggactacccggtcgccctggtcaactcggtgaacatcttccgcctgcac
gggcagaagacggcgtccttcgagatcgtcgaggcgctcggtgacgctccggacatccac
tgcctgccggtcggcaacgccggcaacatctccgcgtactggatggggtaccaggaggac
aaggacgccggcaacagcaccaggctgccgaggatgtacggcttccaggcctccggcgcg
gccccgatcgtcaccggcaaggtggtcgagcagccgtccaccatcgccaccgcgatccgg
atcggcaacccggcgagctggaccaaggcgctggacgcccgggacgcctcgggcggcctg
atctcggcggtcaccgaccgggacatcctgaacgcgtaccgcctgctggcccgggaggtc
ggcgtcttcgtcgagctgggcagcgcggccagcgtggccggcctgctccagcaggcggcg
gccggcaagatcccggccgggtcccgggtggtctgcacggtcaccgggcacgggctcaag
gacccggagtgggcgatctccaccgcgccgtcgccgaccgtgatcgccaacgacgccctg
atcgccgcgaaggccctcgacctggcctga
DBGET
integrated database retrieval system