Actinoplanes oblitus: ACTOB_007950 Help Entry ACTOB_007950      CDS       T09687                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aou  Actinoplanes oblitus Brite KEGG Orthology (KO) [BR:aou00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     ACTOB_007950 Enzymes [BR:aou01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      ACTOB_007950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Glrx-like Thioredoxin SH3BGR VpsR Motif Other DBs NCBI-ProteinID:  WIM95813 LinkDB All DBs Position 8931515..8931757 Genome browser AA seq 80 aa AA seqDB search MLTMYSTSWCGYCHRLKSQLDREGIAYDVVDIEQDEASAAFVRSVNGGNQTVPTLKFDDG SALTNPSIVQVKQHLAAISA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgaccatgtactcgacgtcctggtgtgggtattgccaccggctgaagagccagctc gaccgcgagggcatcgcctatgacgtcgtggacatcgagcaggacgaggcctcggccgcg ttcgtgcgcagcgtgaacggtggcaaccagaccgttcccacgctcaagttcgatgacggc tcggcgttgaccaacccgtcgatcgtccaggtgaagcagcacctggcagcgatctccgcc tga

DBGET integrated database retrieval system