Isoalcanivorax pacificus: S7S_07625 Help Entry S7S_07625         CDS       T03580                                  Name (GenBank) Cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism apac  Isoalcanivorax pacificus Pathway apac00190   Oxidative phosphorylation apac01100   Metabolic pathways apac02020   Two-component system Module apac_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:apac00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     S7S_07625  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     S7S_07625 Enzymes [BR:apac01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      S7S_07625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJD47941 UniProt:  A0A0B4XLH5 LinkDB All DBs Position 1699690..1699815 Genome browser AA seq 41 aa AA seqDB search MWYFSWILGVGLACTFGILNAMWFELNETDTRLRNEDDSSE NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcagctggattctcggtgtcggcctggcgtgcacattcggcattctcaat gccatgtggttcgaactgaatgagaccgacacgcggctgcggaacgaggacgattcatcg gagtaa

DBGET integrated database retrieval system