Isoalcanivorax pacificus: S7S_09575
Help
Entry
S7S_09575 CDS
T03580
Name
(GenBank) GntR family transcriptional regulator
Organism
apac
Isoalcanivorax pacificus
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FCD
GntR
HTH_24
HTH_41
MarR
MarR_2
Motif
Other DBs
NCBI-ProteinID:
AJD48327
UniProt:
A0A0B4XPZ4
LinkDB
All DBs
Position
complement(2126668..2127387)
Genome browser
AA seq
239 aa
AA seq
DB search
MSEPLEKAPQHELSPDIAGTDGRTLADRVFARLQDDIVRGELLPGTKLGETELATRYGVS
RGPLREAIRRLESRKLLERVPHVGTRVASLTLPDLVEIYHVREALEGMAARLAAQHMTDE
EIRGLVALLSQHEQQQDLKEDTAYFQREGDLDFHYRIIQGSHNETLIQMLIGGLYHLVRM
YRYQFSTVANRPQRALQEHRRIIEALEARDGEMAELLMRRHISRARENIERSTPPGENP
NT seq
720 nt
NT seq
+upstream
nt +downstream
nt
atgtctgaacccctggaaaaagccccgcagcacgagctctccccggatatcgccgggacg
gatggccgtaccctggcggacagggtgtttgcccgcctccaggacgacatcgtgcgcggc
gagctgctgcctggtaccaaactgggcgaaaccgagcttgccacccgctacggcgtcagt
cgtggcccgctgcgcgaagccatccgccgccttgaatcccgcaaactgcttgagcgcgtg
ccgcatgtgggcacccgcgtcgcgtccctgaccctgccggatctggtcgagatttaccat
gtgcgcgaagcgctggaaggcatggccgcccgcctggctgcacaacacatgaccgacgaa
gagatccgtggcctggtggcactgctgtcacagcatgagcaacagcaggacctgaaagaa
gacacggcttatttccagcgcgaaggcgacctggattttcattaccgcatcatccagggc
agccataacgagacactgatccagatgctgatcggtgggctgtatcacctggtgcgcatg
taccgctaccagttttccaccgtggccaaccggcctcagcgggcgttgcaggagcatcgt
cgcatcatcgaagccctggaagcacgtgacggcgagatggccgaactgctgatgcgccgg
catatcagccgcgcgcgagagaacatcgaacgctccacgccgccgggcgagaacccctga
DBGET
integrated database retrieval system