Aquidulcibacter paucihalophilus: KB221_08410 Help Entry KB221_08410       CDS       T09139                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apah  Aquidulcibacter paucihalophilus Pathway apah01100   Metabolic pathways apah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KB221_08410    00074 Mycolic acid biosynthesis     KB221_08410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KB221_08410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WIY68131 LinkDB All DBs Position 1740667..1740918 Genome browser AA seq 83 aa AA seqDB search MTDDDIRAVLRDELGRIAPEIDFDGLDPSMDLREQADLDSMDFLNLLTALHQRLGVNIPE SEAAELATIAAAVAYISSRRSGP NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgatgacatccgcgccgtgctgcgcgacgaactgggccggatcgcaccggag atagatttcgacgggctcgatccgtccatggacttgcgggaacaggccgatctcgactcg atggattttctcaacctcttgacggcattgcaccagcgcctcggggtgaacattcccgag tccgaggccgcggagctggcgaccatcgccgccgccgtcgcctatatatcgagcagacga agcggaccttag

DBGET integrated database retrieval system