Malaciobacter pacificus: APAC_0319 Help Entry APAC_0319         CDS       T06712                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apai  Malaciobacter pacificus Pathway apai01100   Metabolic pathways apai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APAC_0319 (acpP)    00074 Mycolic acid biosynthesis     APAC_0319 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APAC_0319 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QEP33481 UniProt:  A0A5C2H3J4 LinkDB All DBs Position complement(307436..307666) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVADAIKYIEDNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagaagtagttgttgagcaattagattgcgatccagca gaagttaaagaagattcaaaatttattgaagatttaggtgctgactctttagacgtagtt gagctagttatggcattagaagagaaatttgacatcgaaatcccagatgaagatgctgaa aaaatcttaactgttgctgatgctattaaatacatcgaagataacgcgtaa

DBGET integrated database retrieval system