Andrographis paniculata: 127239712 Help Entry 127239712         CDS       T08689                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism apan  Andrographis paniculata Pathway apan03018   RNA degradation apan03040   Spliceosome Brite KEGG Orthology (KO) [BR:apan00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     127239712   09123 Folding, sorting and degradation    03018 RNA degradation     127239712  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:apan03019]     127239712    03041 Spliceosome [BR:apan03041]     127239712 Messenger RNA biogenesis [BR:apan03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      127239712   mRNA degradation factors    5'-3' decay     Lsm complex      127239712 Spliceosome [BR:apan03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     127239712 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Hfq KNOX2 Motif Other DBs NCBI-GeneID:  127239712 NCBI-ProteinID:  XP_051113948 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSGRKETVLDLSKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDPEDPLKT TDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFLPDGS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaaaagaaacagttttagatttgtctaagttcgtcgacaaaggtgttcaa gtcaagcttactggtggaaggcaagtcactggaacactgaaagggtatgatcaattgctg aatcttgttttggatgaagccgtagaatttcttagagatccagaggacccactgaagact accgatcaaacccgccgccttgggttaattgtctgccgaggaactgctgtgatgctggtg tctccaactgatggtacagatgaaattgccaatccatttttgcctgatggatcatag

DBGET integrated database retrieval system