Andrographis paniculata: 127260912 Help Entry 127260912         CDS       T08689                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism apan  Andrographis paniculata Pathway apan04145   Phagosome apan04148   Efferocytosis apan04517   IgSF CAM signaling apan04518   Integrin signaling apan04620   Toll-like receptor signaling pathway apan05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:apan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127260912    04518 Integrin signaling     127260912  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127260912    04148 Efferocytosis     127260912  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127260912  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127260912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apan04131]     127260912   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apan04147]     127260912    04031 GTP-binding proteins [BR:apan04031]     127260912 Membrane trafficking [BR:apan04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127260912  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127260912   Macropinocytosis    Ras GTPases     127260912  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127260912 Exosome [BR:apan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127260912   Exosomal proteins of other body fluids (saliva and urine)    127260912   Exosomal proteins of colorectal cancer cells    127260912   Exosomal proteins of bladder cancer cells    127260912 GTP-binding proteins [BR:apan04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127260912 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  127260912 NCBI-ProteinID:  XP_051144920 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENISKKWIPELRHYAPGVPIILVGTKL DLREDKQFFIDHPGAVPISTAQGEDLRKSIGATAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKSCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcgagatttataaagtgcgtcaccgtcggggacggagctgtggggaaaact tgcctgctcatttcgtacaccagcaatactttccctactgattatgtcccaactgtgttc gataatttcagtgcaaatgttgtagtggatggaagtactgttaatctaggattatgggat actgcaggtcaggaggattacaatcgattgagaccattaagctaccgtggagctgatgtt tttatacttgcattctctcttataagcaaggccagttatgagaacatatctaagaagtgg atccctgaattgaggcattatgctcctggagttccaataattcttgtgggaacaaaactt gatctccgtgaggacaagcagttctttatagatcacccaggagctgttccgatctcaact gcacagggagaggacttgaggaaatcgatcggagcaacagcttatatagaatgcagtgct aagacacaacagaatgtgaaagctgtgttcgatgccgcaatcaaggtagtcctgcagcca ccaaagcaaaagaagaagaagaagagaaagggtcaaaagtcgtgcagtatcctgtga

DBGET integrated database retrieval system