Anaeromyxobacter paludicola: AMPC_00310 Help Entry AMPC_00310        CDS       T08525                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apau  Anaeromyxobacter paludicola Pathway apau01100   Metabolic pathways apau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMPC_00310 (acpP)    00074 Mycolic acid biosynthesis     AMPC_00310 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMPC_00310 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BDG06918 LinkDB All DBs Position 28416..28658 Genome browser AA seq 80 aa AA seqDB search MTTANIEAKVKGIIAEQLGVGEDEIKPTSSFIEDLGADSLDIVELVMAMEEEFEVEIPDE EAENIKTVADAVNYINTHKK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgacggcgaacatcgaggcgaaggtcaagggcatcatcgcggagcagctcggcgtg ggcgaggacgagatcaagcccacctccagcttcatcgaggacctcggcgccgactcgctc gacatcgtcgagctggtcatggcgatggaggaggagttcgaggtcgagatccccgacgag gaggccgagaacatcaagaccgtcgccgacgcggtgaactacatcaacacccacaagaag tag

DBGET integrated database retrieval system