KEGG   Candidatus Puniceispirillum marinum: SAR116_2444
Entry
SAR116_2444       CDS       T01207                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00790  Folate biosynthesis
apb01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR116_2444
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     SAR116_2444
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ADE40687
UniProt: D5BQG9
LinkDB
Position
complement(2648298..2648783)
AA seq 161 aa
MIKSIVAVGQNGEIGFKGKLPWEGTFIEDQQWYMDNTLNAVRIGCSGSIKTIDDERAFYI
VSARNIVAPGSLGIYNWQHMKPHEILADVQAKHPTKDVFVVGGVPWYEASAYAVEQLLIT
RINGSYTHDRAINLDILLQNRKCMKSWQGQTTPDLCFEIWE
NT seq 486 nt   +upstreamnt  +downstreamnt
gtgattaagtcaattgtagctgttggacagaatggtgagattggctttaagggcaagcta
ccctgggaaggcaccttcattgaggatcagcaatggtatatggacaacacgctgaacgct
gttcgtattggctgttctggttcgatcaaaaccatagatgacgagcgcgcattctatatt
gtcagtgcgcgtaacatcgtcgcacctggcagccttggtatttataactggcaacatatg
aaaccgcatgaaatccttgccgatgtgcaggccaagcatccgaccaaggatgtttttgtc
gttggcggcgtaccgtggtatgaagccagcgcctatgcggttgaacaattactaatcacg
cggatcaatggtagctatacacatgaccgtgcgattaatttggatattttgttgcaaaac
cgtaaatgcatgaaatcatggcaagggcaaacaacgcctgatctttgctttgaaatatgg
gaatag

DBGET integrated database retrieval system