Anaplasma phagocytophilum Dog2: YYY_01425
Help
Entry
YYY_01425 CDS
T02752
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
apd
Anaplasma phagocytophilum Dog2
Pathway
apd03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
apd00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
YYY_01425
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
apd03011
]
YYY_01425
Ribosome [BR:
apd03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
YYY_01425
Bacteria
YYY_01425
Archaea
YYY_01425
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF5919
DUF987
Motif
Other DBs
NCBI-ProteinID:
AGR81214
LinkDB
All DBs
Position
282363..282728
Genome browser
AA seq
121 aa
AA seq
DB search
MSLFDLKRAERRRRRVRLKLRSLSSIRLSVFKSNRHFYAQLIDDEAGRTVAAASTLESEV
LAVASRRVNAGAVKIVAKLLAERISGLDAAYRKFVFDRGSYRYMGVVAAFADELRSLGFE
F
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atgtcgttgtttgatttgaaaagagcagagaggcgtaggaggcgtgtgaggctaaagctt
aggtctctgtcctctatccggctgtcagtatttaagtctaataggcatttttatgcccaa
ttaatagacgacgaagctggtaggactgttgctgctgcgtctactttggagtcggaagtg
ctggcagtagccagtaggcgtgttaatgcgggggctgttaagattgttgccaagctgcta
gctgagcgtatttctggtttagatgcagcgtatcgcaagtttgtctttgatagaggctct
tataggtatatgggtgtcgttgcagcatttgctgatgaactgaggagtctaggtttcgag
ttttag
DBGET
integrated database retrieval system