Alteromonas pelagimontana: CA267_009240 Help Entry CA267_009240      CDS       T06582                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apel  Alteromonas pelagimontana Pathway apel01100   Metabolic pathways apel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CA267_009240    00074 Mycolic acid biosynthesis     CA267_009240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CA267_009240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJR80949 UniProt:  A0A6M4MCY9 LinkDB All DBs Position complement(2071975..2072238) Genome browser AA seq 87 aa AA seqDB search MSRQTESENKMAQLLVDALNLEDMEAEDINPEEQLFGDGLGLDSIDALEISLAISKEYGV QIKAEDEGTREAFATLRSLTAFVEKNK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctagacaaaccgaatctgaaaataaaatggctcagctattggttgatgcgttaaat cttgaagacatggaagctgaagatattaatccggaagagcaactgtttggtgatggtctt ggccttgattcaattgatgcactggagatatctcttgcgatatcgaaagaatacggcgta caaatcaaagcggaagatgaaggaactcgcgaagcgtttgcaaccttacgaagcctgacc gcgttcgtggaaaaaaataaatag

DBGET integrated database retrieval system