Alteromonas pelagimontana: CA267_015555 Help Entry CA267_015555      CDS       T06582                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism apel  Alteromonas pelagimontana Brite KEGG Orthology (KO) [BR:apel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:apel03032]     CA267_015555 (hupB)    03036 Chromosome and associated proteins [BR:apel03036]     CA267_015555 (hupB)    03400 DNA repair and recombination proteins [BR:apel03400]     CA267_015555 (hupB) DNA replication proteins [BR:apel03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CA267_015555 (hupB) Chromosome and associated proteins [BR:apel03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CA267_015555 (hupB) DNA repair and recombination proteins [BR:apel03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CA267_015555 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QJR82065 UniProt:  A0A6M4MHL0 LinkDB All DBs Position 3532327..3532599 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDQIAAGADISKAAAGRALDAFTDAVTAALKDGDQVALVGFGTFAVRERSARSG RNPQTGETIQIAAAKVPSFKAGKALKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtctcaactcatcgaccaaatcgctgctggtgcagatatttctaaagcagcc gctggccgcgctttagatgcgtttactgatgcagtaactgcagcgctaaaagacggtgac caagttgcactggtaggtttcggtactttcgcagttcgcgagcgttcagctcgtagcggc cgtaaccctcaaactggtgagactattcagatcgcagcagctaaagttccttctttcaaa gcgggtaaagctctgaaagacgcttgtaactaa

DBGET integrated database retrieval system