Acetobacter persici: A0U91_02250 Help Entry A0U91_02250       CDS       T04751                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aper  Acetobacter persici Pathway aper01100   Metabolic pathways aper01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aper00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U91_02250    00074 Mycolic acid biosynthesis     A0U91_02250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U91_02250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AQT04026 UniProt:  A0A1U9LC46 LinkDB All DBs Position 498673..498912 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVEESKVTPEASFIDDLGADSLDTVELVMAFEEAFNVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgctgacaaggttaagaaaattgtggtcgagcatctcggcgttgaagaa agcaaggttacgccggaagcgtcgttcatcgacgatctgggcgcagacagccttgatacc gttgaactcgtgatggcttttgaagaagctttcaacgtcgagattccggaagacgctgct gagaagatcgccacggttaaagacgcgattgactacatcgagaagcagaaagccgcctga

DBGET integrated database retrieval system