Acetobacter persici: A0U91_13910 Help Entry A0U91_13910       CDS       T04751                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aper  Acetobacter persici Pathway aper01100   Metabolic pathways aper01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aper00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0U91_13910    00074 Mycolic acid biosynthesis     A0U91_13910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0U91_13910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AQT05744 UniProt:  A0A1U9LH08 LinkDB All DBs Position complement(3106438..3106689) Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMDDLAFDSLAVMNFVMEVEDSMDVSVPL DKLADIRTINDLAACVVDLKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaactgttgaaagcgtttctgcgctgatcatccagaaacttctcgccaatccg aaagtgccgcgcgacatcgacggtaactgcaagatcatggacgatctggcttttgattct ctggctgtcatgaattttgtcatggaagtggaagacagcatggatgtgtccgtgccgctc gacaagctggctgatatccggaccattaacgaccttgccgcctgcgtggttgatctgaaa aacaaaggctga

DBGET integrated database retrieval system