Aromatoleum petrolei: ToN1_10010 Help Entry ToN1_10010        CDS       T07150                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism apet  Aromatoleum petrolei Pathway apet01100   Metabolic pathways apet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ToN1_10010 (acpP)    00074 Mycolic acid biosynthesis     ToN1_10010 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ToN1_10010 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QTQ35173 LinkDB All DBs Position complement(1070509..1070748) Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgagcagcgcgtcaagaaaattgtcgccgaacaacttggtgtgaacgag tcggaaatcaagatcgagtcctcgttcgtcgacgatctgggcgcggattcgctggatacc gtggaactggttatggccctcgaggaagagttcgagtgcgaaatcccagacgaggaagct gagaagatcaccacggttcagcaggcgattgactacgtcaacgcccacctgaaaaagtaa

DBGET integrated database retrieval system