KEGG Orthology (KO) [BR:apet00001]
09100 Metabolism
09111 Xenobiotics biodegradation and metabolism
00362 Benzoate degradation
ToN1_29630 (hcrB)
00627 Aminobenzoate degradation
ToN1_29630 (hcrB)
Enzymes [BR:apet01000]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.7 With an iron-sulfur protein as acceptor
1.1.7.1 4-hydroxybenzoyl-CoA reductase
ToN1_29630 (hcrB)
KEGG Orthology (KO) [BR:apet00001]
09100 Metabolism
09111 Xenobiotics biodegradation and metabolism
00362 Benzoate degradation
ToN1_29640 (hcrA)
00627 Aminobenzoate degradation
ToN1_29640 (hcrA)
Enzymes [BR:apet01000]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.7 With an iron-sulfur protein as acceptor
1.1.7.1 4-hydroxybenzoyl-CoA reductase
ToN1_29640 (hcrA)
KEGG Orthology (KO) [BR:apet00001]
09100 Metabolism
09111 Xenobiotics biodegradation and metabolism
00362 Benzoate degradation
ToN1_29650 (hcrC)
00627 Aminobenzoate degradation
ToN1_29650 (hcrC)
Enzymes [BR:apet01000]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.7 With an iron-sulfur protein as acceptor
1.1.7.1 4-hydroxybenzoyl-CoA reductase
ToN1_29650 (hcrC)
161 aa
MKKLLTLTVNGRPHEDAVAENALLIDYLRDALSLTGTKQGCDGGECGACTVLVDGEPRLA
CSTLAHSVAGRNIETIEGLSTAGNLSRLQRAFHEHLGAQCGFCTPGMIMAAEALLRRNPQ
PSRDEIRAALAGNLCRCTGYVKILDSVEAAARCGETAGVAA