Aromatoleum petrolei: ToN1_40760 Help Entry ToN1_40760        CDS       T07150                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism apet  Aromatoleum petrolei Pathway apet01100   Metabolic pathways apet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ToN1_40760    00074 Mycolic acid biosynthesis     ToN1_40760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ToN1_40760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QTQ38180 LinkDB All DBs Position 4353445..4353696 Genome browser AA seq 83 aa AA seqDB search MAEKYPELRANVIAILRGIAPEVEADELRDDRPLRQQVDLDSMDWLNFLIGISEQLKVSI PEADYGRLVTLGNLLDYLRAKLG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgagaaatatcccgaactgcgcgcgaatgtgatcgcgatcctgcgtggcatcgcg cccgaggtcgaggcggacgagttgcgcgacgaccggccgctgcgccagcaggtcgacctc gattcgatggactggctcaacttcctgatcgggatcagcgagcagctgaaggtgagcatc cccgaggcggactacggccgcctcgtgacgctggggaatctgctcgactacctgcgcgcg aagctcggctag

DBGET integrated database retrieval system