Abyssogena phaseoliformis symbiont: CVPH_0331 Help Entry CVPH_0331         CDS       T07717                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism aphf  Abyssogena phaseoliformis symbiont Brite KEGG Orthology (KO) [BR:aphf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aphf03032]     CVPH_0331    03036 Chromosome and associated proteins [BR:aphf03036]     CVPH_0331    03400 DNA repair and recombination proteins [BR:aphf03400]     CVPH_0331 DNA replication proteins [BR:aphf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CVPH_0331 Chromosome and associated proteins [BR:aphf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CVPH_0331 DNA repair and recombination proteins [BR:aphf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CVPH_0331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  BBB22459 UniProt:  A0A7U3V245 LinkDB All DBs Position 334146..334421 Genome browser AA seq 91 aa AA seqDB search MNKSGLIDAISSAANLSKADASRALNATTDAITGAMASGDGVQLTGFGSFVVRDRAARTG RNPQTGATIQIKASKVAAFKAGKALKEAVNK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcaggattaatcgatgcaatttcatcagcagcaaacttatctaaagcagat gcctctcgtgcattaaacgcaacaacagatgctattactggcgctatggctagtggtgat ggtgtacaacttactggctttggtagttttgttgttagagaccgtgcagcgcgtacaggt cgcaatccacaaacaggtgcaacgattcaaatcaaagcatcaaaagtggctgcttttaaa gcaggaaaagcattaaaggaggcggttaataagtaa

DBGET integrated database retrieval system