Abyssogena phaseoliformis symbiont: CVPH_0633 Help Entry CVPH_0633         CDS       T07717                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aphf  Abyssogena phaseoliformis symbiont Pathway aphf01100   Metabolic pathways aphf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aphf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CVPH_0633 (acpP)    00074 Mycolic acid biosynthesis     CVPH_0633 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CVPH_0633 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BBB22676 UniProt:  A0A7U3V225 LinkDB All DBs Position complement(645482..645709) Genome browser AA seq 75 aa AA seqDB search MSIEQRVKKVVAEQLDVSGDIDNNASFIDDLGADSLDTVELVMSFEEEFGCEIPDDQAEN ITTVQQAIDYVNNNL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagtattgagcaaagagtaaaaaaagttgtagctgaacaattagacgtaagcggtgat attgataacaacgcttcttttattgatgatttaggtgcagattctttggatactgttgaa ttggtcatgtcttttgaagaagagtttggctgcgaaattcctgacgatcaagccgaaaat attaccacagttcaacaagcaattgactacgttaacaataatttgtaa

DBGET integrated database retrieval system