Acyrthosiphon pisum (pea aphid): 100159309 Help Entry 100159309         CDS       T01076                                  Symbol Hspe1 Name (RefSeq) heat shock 10kDa protein 1   KO K04078   chaperonin GroES Organism api  Acyrthosiphon pisum (pea aphid) Brite KEGG Orthology (KO) [BR:api00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:api03110]     100159309 (Hspe1)    03029 Mitochondrial biogenesis [BR:api03029]     100159309 (Hspe1) Chaperones and folding catalysts [BR:api03110]  Heat shock proteins   HSP10    100159309 (Hspe1) Mitochondrial biogenesis [BR:api03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     100159309 (Hspe1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 MSSS Motif Other DBs NCBI-GeneID:  100159309 NCBI-ProteinID:  NP_001119666 APHIDBASE:  ACYPI000693 UniProt:  Q201Y3 LinkDB All DBs Position A2:complement(43617343..43618492) Genome browser AA seq 101 aa AA seqDB search MASVATKFRPLFDRVLVKRLDAVKQSKGGIMLPESASKKIREATVIAVGPGARNQDGKPV PIDVNVGDRVLLPEYGGTAIQLDDDDSYTIFKESELLAKVE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcttcagttgcaaccaagttccgcccactctttgatcgtgttttggtcaaacgtttg gatgctgttaagcaaagcaaaggaggtataatgttgccagaaagtgcttcaaaaaaaatt cgtgaggcaactgtcatagctgtaggacccggtgcaagaaatcaggacggaaaaccagta ccaattgatgttaatgttggtgaccgagtattgttaccagagtatggaggtactgcaatt caattagacgatgacgattcatacacaattttcaaagaatcagaattattagcaaaagta gagtaa

DBGET integrated database retrieval system