Acyrthosiphon pisum (pea aphid): 100162914 Help Entry 100162914         CDS       T01076                                  Name (RefSeq) roadblock-like   KO K10419   dynein light chain roadblock-type Organism api  Acyrthosiphon pisum (pea aphid) Pathway api04145   Phagocytosis api04814   Motor proteins Brite KEGG Orthology (KO) [BR:api00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100162914   09142 Cell motility    04814 Motor proteins     100162914  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:api04131]     100162914   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:api03037]     100162914    04812 Cytoskeleton proteins [BR:api04812]     100162914 Membrane trafficking [BR:api04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     100162914 Cilium and associated proteins [BR:api03037]  Motile cilia and associated proteins   Dynein arm    100162914 Cytoskeleton proteins [BR:api04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100162914 SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 UPF0176_N AF0774 Motif Other DBs NCBI-GeneID:  100162914 NCBI-ProteinID:  NP_001155557 APHIDBASE:  ACYPI004033 UniProt:  A0A8R1TE61 C4WVV2 LinkDB All DBs Position X Genome browser AA seq 100 aa AA seqDB search MASEVEDTLKRIQSHRGVIGTIVVNNEGIPIKSTLDNSTSVQYAGLIQQLADKARSVVRD LDPSNDLMFLRMRTKKHEIMVAPDKDFIMIVIQNPTEAQS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctagcgaagttgaagatactttaaaacgcattcaatcgcaccgtggagtcatcggt acaattgtagtaaataacgaaggcattcctattaagtcaactttggacaattcaacttcg gtccaatacgctggattgatacaacagttagctgataaagctaggagtgttgtgagagat ttggatccatctaacgatttgatgttcttgaggatgcgtactaaaaaacatgagataatg gtggctccagataaagatttcattatgatcgttattcaaaacccaacagaagcacagtca taa

DBGET integrated database retrieval system