Acyrthosiphon pisum (pea aphid): 100164159 Help Entry 100164159         CDS       T01076                                  Name (RefSeq) ribosomal protein S27A-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism api  Acyrthosiphon pisum (pea aphid) Pathway api03010   Ribosome api04120   Ubiquitin mediated proteolysis api04137   Mitophagy - animal api04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:api00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     100164159   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100164159  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100164159    04137 Mitophagy - animal     100164159  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:api03011]     100164159    04121 Ubiquitin system [BR:api04121]     100164159   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:api04147]     100164159 Ribosome [BR:api03011]  Ribosomal proteins   Eukaryotes    Small subunit     100164159   Archaea     100164159 Ubiquitin system [BR:api04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    100164159 Exosome [BR:api04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100164159   Exosomal proteins of colorectal cancer cells    100164159 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD DUF2604 Dsc3_N UBL_UBAC1 Ubiquitin_5 TBK1_ULD Motif Other DBs NCBI-GeneID:  100164159 NCBI-ProteinID:  NP_001155610 APHIDBASE:  ACYPI005197 UniProt:  C4WU28 LinkDB All DBs Position A2:<52792139..52793381 Genome browser AA seq 150 aa AA seqDB search MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKRKIKLAVLKFYKVDENGKVIRLKKE CTSENCGPGVFMADMPNRHYCGKCSATVPK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagacgttgactgggaaaacgatcactctcgaagtagagtcgtcg gattcaattgaaaatgtgaaatccaaaattcaagataaagaaggtattcctccggatcag caacgtttgatatttgccggcaaacaacttgaagatggccgtactttgtcagattacaac attcaaaaagaatctaccctccacttggttcttagactgagaggtggtgctaagaaacgt aagaagaagaattattctacaccaaaaaagatcaagcacaagaaaaggaagattaagttg gctgtgttgaaattttacaaagttgatgaaaatggtaaggttatccgtttgaagaaagaa tgtacttctgaaaattgtggtcccggagtattcatggctgacatgccaaacaggcattat tgtggaaaatgttcagctactgttccaaagtag

DBGET integrated database retrieval system