KEGG   Acyrthosiphon pisum (pea aphid): 100165691
Entry
100165691         CDS       T01076                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    100165691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:api00199]
    100165691
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     100165691
Cytochrome P450 [BR:api00199]
 Cytochrome P450, animal type
  CYP306 family
   100165691
SSDB
Motif
Pfam: p450 Stk19
Other DBs
NCBI-GeneID: 100165691
NCBI-ProteinID: XP_001947874
APHIDBASE: ACYPI006623
UniProt: J9K1J0
LinkDB
Position
A2:93321665..93357108
AA seq 492 aa
MFWIIGVILFGVLCAGYLWRSNRNLPPGPWGVPIFGYLPWLNPTEPYKTLTALASKYGPI
YSIQMGKHFAVVMSDPTLVRMALARNELADRTNFEVVNEIMQEHGLIFTHGPLWKEQRKF
VCNWLKVIGVTKFGDKKNNLQLLIADAVSTTISKLRQSNNRPIDTGTFFLVHIGDFINLI
VLGKAWPEDDPNWIYLRNLAEDGSKKFAIATPLSVLPILKIIPKYRNTVFEVIEGVKNTH
LIYKTLMEKRGNEIHESDDLMAMFMKEMTKRKNDKDSHYFTEKQCCFLLSDLFGAGVETT
VNTLRWFLLYMALNQEIQNDLQKLLDSACTDGGLIGLEQIESIPLLKACVSETMRLRPVA
PSGIPRSVNTEITISGYRIPKGTMVLPLQWAMHHDEKYWTDPETFRPKRFLDDEGNMINH
KAFMPFQAGKRACVGDTLSYWILYLFGANIIHNFNVSAEQGLSEKEINTIMDGEFGITLS
PATHKVVFKSRI
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgttttggatcatcggcgtaatactatttggagtattatgtgctggctacctgtggcgt
tccaacagaaacttacccccaggtccttggggtgttccaattttcggctatctaccgtgg
ttaaatccaaccgaaccttacaaaacgttaacggcactggctagtaagtatggaccgatt
tacagcattcagatgggcaaacattttgcagtcgttatgtcggacccgacactggttaga
atggccttagcgaggaacgaactagcagatcgcaccaacttcgaagttgtcaatgaaata
atgcaagaacatggtttgatatttacacacgggcctctttggaaagaacaacgaaaattt
gtttgcaattggcttaaggtgatcggcgtgaccaagttcggggacaagaaaaataactta
caactacttattgccgacgccgtgtctactacgatctcgaaattacgtcaatcaaataat
cgtccgattgacacggggacgttttttcttgtacacataggagatttcataaatctcata
gtgttgggtaaagcgtggccagaagatgaccctaattggatttatttacgaaatttggct
gaagacggatccaaaaaattcgccatagccaccccattaagtgttttgccaatattgaag
ataataccgaaatacagaaatactgtttttgaagtaatcgagggagttaaaaacacgcat
ctcatatataaaactttgatggagaaacgaggcaacgaaattcacgaaagtgacgatctg
atggccatgttcatgaaagaaatgaccaagagaaaaaatgacaaggattcccattacttc
accgaaaaacaatgttgttttcttctgtctgatcttttcggtgctggtgtcgaaacaacc
gtaaataccctaagatggtttcttctgtacatggctttaaaccaagaaatacaaaacgac
ttacagaaattgctggattctgcgtgtaccgatggtggattaataggtctagagcaaata
gaaagcattccgctgctaaaagcttgcgtgtctgaaacgatgcgattgcggccggtggct
ccgtctggtataccgcggtcggtgaacaccgaaattacgatttcgggataccgcatacca
aaagggaccatggttttaccgctgcagtgggcaatgcatcacgacgaaaaatattggacg
gacccggagacgttccgaccgaaaagatttttggacgacgaagggaatatgatcaaccac
aaggccttcatgccatttcaagccggtaaaagagcttgtgtcggagacacgctttcctac
tggatactctatctgttcggtgcaaatataatccacaatttcaatgtttccgcagaacaa
ggtctatctgaaaaagaaatcaacaccatcatggacggggagtttggcataacgctcagt
ccggccacgcacaaagttgtttttaaatctcgaatttaa

DBGET integrated database retrieval system