Acyrthosiphon pisum (pea aphid): 100575545 Help Entry 100575545         CDS       T01076                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism api  Acyrthosiphon pisum (pea aphid) Brite KEGG Orthology (KO) [BR:api00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:api03036]     100575545   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:api04147]     100575545 Chromosome and associated proteins [BR:api03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100575545 Exosome [BR:api04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100575545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa DUF7320 Motif Other DBs NCBI-GeneID:  100575545 NCBI-ProteinID:  XP_003246588 UniProt:  A0A8R1W6M8 LinkDB All DBs Position A3:complement(29386434..>29386760) Genome browser AA seq 91 aa AA seqDB search TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDVRFQSSAVMALQEASEAYLVGLF EDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt accgtcgccctccgtgaaatccgtcgttatcagaagagcacggaactcttgatccgcaaa ttgccgttccaacgtctagtgcgcgagatcgcccaggacttcaagaccgacgtgcgtttc cagagctccgccgtcatggcgttgcaagaagctagcgaggcgtacttggtgggtctgttc gaagacaccaatctttgcgcaatccacgccaagcgtgtcacgatcatgccaaaggacatc cagttggcccgtcgtatccgcggtgaacgtgcctaa

DBGET integrated database retrieval system