Acyrthosiphon pisum (pea aphid): 103310742 Help Entry 103310742         CDS       T01076                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism api  Acyrthosiphon pisum (pea aphid) Pathway api03010   Ribosome api04120   Ubiquitin mediated proteolysis api04137   Mitophagy - animal api04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:api00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     103310742   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103310742  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103310742    04137 Mitophagy - animal     103310742  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:api03011]     103310742    04121 Ubiquitin system [BR:api04121]     103310742   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:api04147]     103310742 Ribosome [BR:api03011]  Ribosomal proteins   Eukaryotes    Small subunit     103310742   Archaea     103310742 Ubiquitin system [BR:api04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    103310742 Exosome [BR:api04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103310742   Exosomal proteins of colorectal cancer cells    103310742 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD DUF2604 Dsc3_N Ubiquitin_5 UBL_UBAC1 TBK1_ULD Motif Other DBs NCBI-GeneID:  103310742 NCBI-ProteinID:  XP_008188214 UniProt:  C4WU28 LinkDB All DBs Position A3:complement(12355057..12355729) Genome browser AA seq 150 aa AA seqDB search MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKRKIKLAVLKFYKVDENGKVIRLKKE CTSENCGPGVFMADMPNRHYCGKCSATVPK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagacgttgactgggaaaacgatcactctcgaagtagagtcgtcg gattcaattgaaaatgtgaaatccaaaattcaagataaagaaggtattcctccggatcag caacgtttgatatttgccggcaaacaacttgaagatggccgtactttgtcagattacaac attcaaaaagaatctaccctccacttggttcttagactgagaggtggtgctaagaaacgt aagaagaagaattattctacaccaaaaaagatcaagcacaagaaaaggaagattaagttg gctgtgttgaaattttacaaagttgatgaaaatggtaaggttatccgtttgaagaaagaa tgtacttctgaaaattgtggtcccggagtattcatggctgacatgccaaacaggcattat tgtggaaaatgttcagctactgttccaaagtag

DBGET integrated database retrieval system