Acetobacter pasteurianus 386B: APA386B_535 Help Entry APA386B_535       CDS       T02786                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apk  Acetobacter pasteurianus 386B Pathway apk01100   Metabolic pathways apk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APA386B_535    00074 Mycolic acid biosynthesis     APA386B_535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APA386B_535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CCT58650 LinkDB All DBs Position 540393..540644 Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIEKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSIPL DKLADIRTINDLAACIVALKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttccgcgctgatcattgaaaagctcctcgccaacccg aaggttccgcgtgacattgatggtaactgcaagatcatggaagatctcgcatttgattct ttggccgtcatgaacttcgttatggaagttgaagacagcttggatgtctccatcccgctc gacaaactggccgatatccggacaatcaatgaccttgccgcatgcattgtcgctctgaaa aacaaagggtga

DBGET integrated database retrieval system