Anas platyrhynchos (mallard): 101795525 Help Entry 101795525         CDS       T02816                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism apla  Anas platyrhynchos (mallard) Pathway apla04068   FoxO signaling pathway apla04136   Autophagy - other apla04140   Autophagy - animal apla04621   NOD-like receptor signaling pathway apla04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101795525 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101795525 (ATG12)    04136 Autophagy - other     101795525 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101795525 (ATG12)    04622 RIG-I-like receptor signaling pathway     101795525 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101795525 (ATG12)    04121 Ubiquitin system [BR:apla04121]     101795525 (ATG12)    03029 Mitochondrial biogenesis [BR:apla03029]     101795525 (ATG12) Membrane trafficking [BR:apla04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101795525 (ATG12) Ubiquitin system [BR:apla04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101795525 (ATG12) Mitochondrial biogenesis [BR:apla03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101795525 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  101795525 NCBI-ProteinID:  XP_027302046 UniProt:  A0A8B9SYI8 LinkDB All DBs Position Z:68121658..68125265 Genome browser AA seq 139 aa AA seqDB search MAEDGEQAAVSPQGEAGEEAAESGTAAAGAAEPVPPAAGSPGSEEPGGDAKKKIDVLLKA VGDTPIMRTKKWAVERTRTIQGLVDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVGTLYE CFGSDGKLVLHYCKTQAWG NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcggaggacggggagcaggcggcggtgtcgcctcaaggggaagccggggaggaggct gcggaaagcgggacggcggcggcgggcgctgctgagccggtgcctcccgcggccggctcg ccgggcagcgaggaacccggcggcgacgccaagaagaaaattgacgtgctgctgaaggcc gtgggcgacacccccatcatgaggaccaagaagtgggccgtggagcgcacccgcaccatc caggggctcgtcgacttcatcaagaagttcctgaagctgatggcctccgagcagctgttc atatatgtgaaccagtcttttgctccgtctccagaccaggaagttgggaccctctatgag tgttttggaagtgatggcaagctggtgctgcattattgcaaaacccaggcatgggggtga

DBGET integrated database retrieval system