Anas platyrhynchos (mallard): 101796887 Help Entry 101796887         CDS       T02816                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism apla  Anas platyrhynchos (mallard) Pathway apla04010   MAPK signaling pathway apla04137   Mitophagy - animal apla04140   Autophagy - animal apla04218   Cellular senescence apla04371   Apelin signaling pathway apla04625   C-type lectin receptor signaling pathway apla04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101796887 (RRAS2)    04371 Apelin signaling pathway     101796887 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101796887 (RRAS2)    04137 Mitophagy - animal     101796887 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     101796887 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101796887 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101796887 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apla04147]     101796887 (RRAS2)    04031 GTP-binding proteins [BR:apla04031]     101796887 (RRAS2) Exosome [BR:apla04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101796887 (RRAS2)   Exosomal proteins of bladder cancer cells    101796887 (RRAS2) GTP-binding proteins [BR:apla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101796887 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  101796887 NCBI-ProteinID:  XP_027317484 Ensembl:  ENSAPLG00000006871 UniProt:  A0A8B9T366 LinkDB All DBs Position 5:63600303..63632579 Genome browser AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQ ECPPSPEPTRKEKDKKGCHCVIF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccggggcaggagaaataccggctggtggtggtgggc ggcggcggcgtgggcaagtctgcgctcaccatccagttcatccagtcctattttgttacg gattatgacccaacgatcgaagactcctacaccaaacaatgtgtgatagacgaaagagct gcgcgcttggacattctggatacagcaggacaagaagaatttggagccatgcgtgaacag tacatgaggacaggggaggggtttctgcttgttttctcagtcactgacagaggaagtttt gaagaaatctataagtttcagcgacaaattcttagagtgaaagatcgtgatgagtttcct atgattctagttggtaataaagcagatctggaccaccaaagacaggtgacacaggaggaa ggccagcagctagcgcgacaacttaaagtaacgtacatggaagcctcagcaaaaatccga ttgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaatttcaagaacaa gagtgccctccttcaccagagccaacacggaaagagaaagacaagaaaggctgccattgt gttattttctga

DBGET integrated database retrieval system