Anas platyrhynchos (mallard): 101797156 Help Entry 101797156         CDS       T02816                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism apla  Anas platyrhynchos (mallard) Pathway apla04145   Phagocytosis apla04814   Motor proteins apla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apla00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101797156 (DYNLT1)   09142 Cell motility    04814 Motor proteins     101797156 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101797156 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:apla03037]     101797156 (DYNLT1)    04812 Cytoskeleton proteins [BR:apla04812]     101797156 (DYNLT1) Cilium and associated proteins [BR:apla03037]  Motile cilia and associated proteins   Dynein arm    101797156 (DYNLT1) Cytoskeleton proteins [BR:apla04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101797156 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  101797156 NCBI-ProteinID:  XP_038031775 Ensembl:  ENSAPLG00000013313 LinkDB All DBs Position 3 Genome browser AA seq 113 aa AA seqDB search MDDFQAGDETSFVVDEVSNIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccaggcgggggacgagacttcctttgtcgttgatgaagtcagtaacatc attaaggaggccatagaaagtgccattggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaactctaagccaactcacgaagctggggaaaccc ttcaagtatatcgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagcg agctcttgcttctgggacaactccagtgatggaacttgtactgtgagatgggagaataag accatgtactgtattgtcagtgccttcggacttgcaatatga

DBGET integrated database retrieval system