Anas platyrhynchos (mallard): 101802089 Help Entry 101802089         CDS       T02816                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism apla  Anas platyrhynchos (mallard) Pathway apla04810   Regulation of actin cytoskeleton apla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apla00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101802089 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101802089 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101802089 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:apla04812]     101802089 (PFN4)    04147 Exosome [BR:apla04147]     101802089 (PFN4) Membrane trafficking [BR:apla04131]  Others   Actin-binding proteins    Others     101802089 (PFN4) Cytoskeleton proteins [BR:apla04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101802089 (PFN4) Exosome [BR:apla04147]  Exosomal proteins   Proteins found in most exosomes    101802089 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101802089 NCBI-ProteinID:  XP_021123438 Ensembl:  ENSAPLG00000013316 LinkDB All DBs Position 3:complement(112277080..112282712) Genome browser AA seq 129 aa AA seqDB search MSQLQALLNDGLIRTKHVENAAIININERKVCASTSGFYVPPENAINLIYTFYNNLMQVR REGLYFKQKHYKCVRADEDSIYLKNPDGGLIAVKTNAFILIATYKVGMYPSVCVEAVEKL ADYFRDKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccaacttcaggctttgttgaatgacggtcttatcagaacaaagcacgtggaaaat gcagctattatcaacataaatgaaagaaaagtctgtgcatcaacctctggcttttatgtg ccaccagagaatgccataaacctgatctacactttctacaataatttaatgcaagtcaga agggaaggactctacttcaagcagaagcactataaatgtgtccgagcagatgaggattcc atctatcttaaaaacccagatggaggcctgatagctgtgaagaccaatgctttcatccta attgctacttacaaggtgggcatgtatcccagcgtgtgcgtggaagctgtagagaaactc gcagactactttagagacaagggcagctga

DBGET integrated database retrieval system