Anas platyrhynchos (mallard): 101804010 Help Entry 101804010         CDS       T02816                                  Symbol IL8 Name (RefSeq) interleukin-8 precursor   KO K10030   interleukin 8 Organism apla  Anas platyrhynchos (mallard) Pathway apla04060   Cytokine-cytokine receptor interaction apla04218   Cellular senescence apla04620   Toll-like receptor signaling pathway apla04621   NOD-like receptor signaling pathway apla04622   RIG-I-like receptor signaling pathway apla05132   Salmonella infection apla05164   Influenza A Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101804010 (IL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101804010 (IL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101804010 (IL8)    04621 NOD-like receptor signaling pathway     101804010 (IL8)    04622 RIG-I-like receptor signaling pathway     101804010 (IL8)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101804010 (IL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     101804010 (IL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:apla04052]     101804010 (IL8)    00536 Glycosaminoglycan binding proteins [BR:apla00536]     101804010 (IL8) Cytokines and neuropeptides [BR:apla04052]  Cytokines   Chemokines    101804010 (IL8) Glycosaminoglycan binding proteins [BR:apla00536]  Heparan sulfate / Heparin   Chemokines    101804010 (IL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain DUF4416 Motif Other DBs NCBI-GeneID:  101804010 NCBI-ProteinID:  NP_001297349 Ensembl:  ENSAPLG00000012697 UniProt:  Q0WZB5 LinkDB All DBs Position 4:complement(46654447..46657548) Genome browser AA seq 103 aa AA seqDB search MNGKLGVVLALLLISVALSQGRSLVRMGNELRCQCISTHSKFIHPKSIQDVKLTQSGPHC KNVEIIATLKDNREVCLDPTAPWVQRIVKAILAKAQLNSDAPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaaacttggggttgtcctggctcttctcttgatttccgtggctctgtcccaa ggcaggagcctggtaaggatgggaaacgagctccggtgccagtgcataagcactcactcg aagttcatccaccctaaatctattcaagatgtgaagctgacgcagagtggcccccactgc aagaacgttgaaatcatagctactctgaaggacaacagagaggtgtgcttggaccccact gctccctgggtacagcggatcgtaaaggcaattctggccaaggctcagctcaattctgat gcaccgctgtaa

DBGET integrated database retrieval system