Anas platyrhynchos (mallard): 101804092 Help Entry 101804092         CDS       T02816                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism apla  Anas platyrhynchos (mallard) Pathway apla04621   NOD-like receptor signaling pathway apla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apla00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101804092 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101804092 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:apla03110]     101804092 (TXN) Chaperones and folding catalysts [BR:apla03110]  Protein folding catalysts   Protein disulfide isomerase    101804092 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 AhpC-TSA Thioredoxin_8 Glutaredoxin OST3_OST6 Thioredoxin_7 Thioredoxin_9 Redoxin PedC-like Motif Other DBs NCBI-GeneID:  101804092 NCBI-ProteinID:  XP_027302023 Ensembl:  ENSAPLG00000008771 LinkDB All DBs Position Z Genome browser AA seq 105 aa AA seqDB search MVKSVGSLSEFETELKSAGDKLVVVDFSATWCGPCKMIKPFFHSLCEKFGDVVFIEIDVD DAQDVATHCEVKCMPTFQFYKNGKMVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagagcgtgggcagcctgtctgagtttgagacagaactgaagtctgctggtgac aagcttgtagtagttgacttctcggccacatggtgtggaccatgcaaaatgatcaagcca tttttccatagtttgtgtgagaaatttggggatgtggtgttcatcgaaatcgacgtggat gacgcccaggatgttgctacacactgtgaggtgaagtgcatgccaacattccagttctac aagaatggaaagatggtgcaggaattctctggggccaataaagaaaaactggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system