Anas platyrhynchos (mallard): 101804733 Help Entry 101804733         CDS       T02816                                  Symbol NRAS Name (RefSeq) LOW QUALITY PROTEIN: GTPase NRas   KO K07828   GTPase NRas Organism apla  Anas platyrhynchos (mallard) Pathway apla04010   MAPK signaling pathway apla04012   ErbB signaling pathway apla04068   FoxO signaling pathway apla04137   Mitophagy - animal apla04140   Autophagy - animal apla04150   mTOR signaling pathway apla04210   Apoptosis apla04218   Cellular senescence apla04370   VEGF signaling pathway apla04371   Apelin signaling pathway apla04540   Gap junction apla04625   C-type lectin receptor signaling pathway apla04810   Regulation of actin cytoskeleton apla04910   Insulin signaling pathway apla04912   GnRH signaling pathway apla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101804733 (NRAS)    04012 ErbB signaling pathway     101804733 (NRAS)    04370 VEGF signaling pathway     101804733 (NRAS)    04371 Apelin signaling pathway     101804733 (NRAS)    04068 FoxO signaling pathway     101804733 (NRAS)    04150 mTOR signaling pathway     101804733 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101804733 (NRAS)    04137 Mitophagy - animal     101804733 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101804733 (NRAS)    04218 Cellular senescence     101804733 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101804733 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101804733 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101804733 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101804733 (NRAS)    04912 GnRH signaling pathway     101804733 (NRAS)    04916 Melanogenesis     101804733 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101804733 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apla04147]     101804733 (NRAS)    04031 GTP-binding proteins [BR:apla04031]     101804733 (NRAS) Membrane trafficking [BR:apla04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101804733 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101804733 (NRAS) Exosome [BR:apla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101804733 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101804733 (NRAS)   Exosomal proteins of breast cancer cells    101804733 (NRAS)   Exosomal proteins of colorectal cancer cells    101804733 (NRAS) GTP-binding proteins [BR:apla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101804733 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  101804733 NCBI-ProteinID:  XP_005011831 UniProt:  A0A8B9QVY7 LinkDB All DBs Position 27:complement(6582863..6590844) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggggccggtggcgtcggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcatac agaaagcaggttgttattgatggagagacgtgcttgttagatattctggacactgcagga caggaagaatatagtgctatgcgtgatcagtacatgagaactggggaaggattcctctgc gtgtttgccattaacaacagtaaatcatttgctgatattaacctgtacagagagcaaatc aagagagtgaaagattcagatgatgtgccaatggttctggttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc tttatagagacatcagctaaaacaagacagggtgttgaagatgctttttacacgctggtg agagagatccggcagtaccggatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattgtcctgcattgtgatgtga

DBGET integrated database retrieval system