Anas platyrhynchos (mallard): 113844859 Help Entry 113844859         CDS       T02816                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism apla  Anas platyrhynchos (mallard) Brite KEGG Orthology (KO) [BR:apla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:apla03019]     113844859    03029 Mitochondrial biogenesis [BR:apla03029]     113844859 Messenger RNA biogenesis [BR:apla03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      113844859 Mitochondrial biogenesis [BR:apla03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     113844859 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  113844859 NCBI-ProteinID:  XP_027322121 LinkDB All DBs Position 12:complement(13217877..13219141) Genome browser AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactcccaggactgcccttgcgccactggtggcacctgcacctgcggggacaactgc aaatgtaaaaactgcaaatgcacgtcgtgcaaaaaaggctgctgctcctgctgccccgcg ggatgtgccaagtgcgcgcagggctgcgtctgcaaagggcccccctccgccaagtgcagc tgctgcaagtag

DBGET integrated database retrieval system